PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G10180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 837aa    MW: 91689 Da    PI: 8.5547
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G10180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-19115170257
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      r+ + +t +q e+L+++F+++++p++++ ++LAk+l++te+q+k+WFqN R+k+kk
  OGLUM08G10180.1 115 RRYQLLTMQQKETLNRAFQSCPNPDRNDLKKLAKELNMTETQIKYWFQNCRTKMKK 170
                      6677899************************************************8 PP

2START104.61.7e-333215497204
                      HHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
            START   7 aqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                      ++e++ k +++ p+W         es+n++e+l k  +  +     +++ + r++++v + +++lv++lld + +W e ++    +a t++ is
  OGLUM08G10180.1 321 ENESLVKKKENGPLWLPHMdilgvESLNYQEYLAKSRTI-GqkpvdFKVVVTRDTAIVNGSCVDLVKSLLDAN-RWRELFPgivaSANTTKIIS 412
                      5666777788899999888899999********999553.3589999**************************.******99999********* PP

                      TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..........-TTSEE...-EESSEEEEEEEECTCE CS
            START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.........sssvvR...aellpSgiliepksngh 161
                      +g      g lqlm aelq++sp vp  d++f+R++ q g g w +vd S+d   + ++         ss  +R   ++llpSg++ie+++ng+
  OGLUM08G10180.1 413 TGlsnlhdGLLQLMRAELQVMSPEVPvCDVTFLRQSVQFGSGLWCVVDASIDTILPGESktaqsivqtSSTAARrmeVRLLPSGCVIEEMENGY 506
                      ***************************************************98777766653333443222223455899************** PP

                      EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
            START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                      sk+tw+ h+ +++r ++ l++sl++s  a ga +wva lqr+ 
  OGLUM08G10180.1 507 SKLTWMVHAAYDERAVPVLYHSLLRSAKALGACRWVASLQRHS 549
                      *****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-15101153IPR009057Homeodomain-like
SuperFamilySSF466899.61E-18103172IPR009057Homeodomain-like
PROSITE profilePS5007115.742111171IPR001356Homeobox domain
SMARTSM003891.9E-17113175IPR001356Homeobox domain
CDDcd000864.92E-18114170No hitNo description
PfamPF000464.4E-17115170IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-4154196IPR009057Homeodomain-like
CDDcd146864.23E-4162199No hitNo description
PROSITE profilePS5084823.672297554IPR002913START domain
CDDcd088752.20E-89301550No hitNo description
SuperFamilySSF559611.07E-18301549No hitNo description
SMARTSM002342.8E-10313551IPR002913START domain
PfamPF018521.4E-26321549IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 837 aa     Download sequence    Send to blast
MGRPVAPRLG SPLSSPAAAH AAAGAPAPSR AARWGRGSPR PCAVLAIPLV EVMDGELKLM  60
ASYVSKLKFI LQKDQQQEPH TANLLVLLGS SNQDKRNGLS QGENRMDTCT RKKPRRYQLL  120
TMQQKETLNR AFQSCPNPDR NDLKKLAKEL NMTETQIKYW FQNCRTKMKK FKNNEERKLL  180
QKENEELKKE NAELRNRMKN STCRACDLPL FHIDCRHWEN PMLNKGNHGV TSNLIPQAVS  240
SLLPSSSGFV ASGSNLSSNA VLMPVSAMPS SVLQPAPAVS GANFPILHNL SANANDGYTE  300
KNVLLDLANR AMEEFFSLMK ENESLVKKKE NGPLWLPHMD ILGVESLNYQ EYLAKSRTIG  360
QKPVDFKVVV TRDTAIVNGS CVDLVKSLLD ANRWRELFPG IVASANTTKI ISTGLSNLHD  420
GLLQLMRAEL QVMSPEVPVC DVTFLRQSVQ FGSGLWCVVD ASIDTILPGE SKTAQSIVQT  480
SSTAARRMEV RLLPSGCVIE EMENGYSKLT WMVHAAYDER AVPVLYHSLL RSAKALGACR  540
WVASLQRHSQ FLSGLHKYIF CPDSTMTEVV MRRKVLYLVK QMTSSFTGLF ASMSKATLQD  600
GDDTHFAHQI VGGATGEPAG LLLSATTTIW LPGVNPRRVY DHLRDEQCHG EWRCLLGEQL  660
HQGNALPYGA PLNGETVPEF YRMVNGLHEG HAISLISPRE MGGNISNTLL LQEARTDLSG  720
SLIVYARTDV NTVHSIMNSG LNPATVFLVS SGCAILPDCL ESFPLHPAAT ADQAGTSSAA  780
IASRSETGGS FVTVTYQMFF SSQGGAAPAS SSIHQGRDAL KKATDIFKVV LDTLTVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1004410.0AK100441.1 Oryza sativa Japonica Group cDNA clone:J023089M04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650915.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like isoform X1
RefseqXP_015650916.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like isoform X1
TrEMBLA0A0E0ATG60.0A0A0E0ATG6_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g19590.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP169781212
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-91protodermal factor 2